PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00189g00919.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family TALE
Protein Properties Length: 961aa    MW: 107917 Da    PI: 6.6098
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00189g00919.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-094134501954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Peaxi162Scf00189g00919.1 413 FEHflHPYPKDSEKITLARQTGLTRSQVANWFINARVR 450
                               554459******************************88 PP

2Homeobox27.17.2e-099029391954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +e+  L++++gL+++qV++WF N R +
  Peaxi162Scf00189g00919.1 902 FEHflHPYPNDSEKLMLSSQTGLSKNQVSNWFINARVR 939
                               554459******************************88 PP

3BELL119.41.6e-38279350172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               er++l++k +kL s+l+eVd+rYk y++q+q+++ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  Peaxi162Scf00189g00919.1 279 ERHDLESKMTKLFSMLDEVDRRYKDYYQQMQVMVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 350
                               799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.3E-56202348IPR006563POX domain
PfamPF075268.7E-47208346IPR006563POX domain
PROSITE profilePS5007112.406391454IPR001356Homeobox domain
SMARTSM003894.3E-10394458IPR001356Homeobox domain
CDDcd000866.01E-12394455No hitNo description
SuperFamilySSF466897.7E-17395460IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27397460IPR009057Homeodomain-like
PfamPF059203.6E-17411450IPR008422Homeobox KN domain
PfamPF075267.2E-6751828IPR006563POX domain
PROSITE profilePS5007111.629880943IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-26882955IPR009057Homeodomain-like
CDDcd000863.24E-10883944No hitNo description
SMARTSM003894.2E-9883947IPR001356Homeobox domain
SuperFamilySSF466891.41E-16889950IPR009057Homeodomain-like
PfamPF059202.1E-16900939IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MSAYYSNLSN QREVLPMSFL PDQKYASYQS TGLSDSSIHL NQHSASVSYS ELPAHNYGDV  60
QTLRGKDEML FIPPTSESAV NAASNFLENS VMMDPRSFPT KQLLVPNVEQ SLQNQGLSLS  120
LGTQVPPSLH VYSYQDDYTN SSLSSLVGTH VLHSGQGSDN KEPKVAEYLS FDLAGGSRAA  180
NNPESSMSLR EMSTGTRLNV GSGVAAAIYN SKYLKAAQEL LDEVVNVHEA LKQSDRLRNF  240
NLLRQDRSEE ADLKSSCSAT GISGEHNNST RANELSPAER HDLESKMTKL FSMLDEVDRR  300
YKDYYQQMQV MVSSFEMVAG LGAAKPYTSL ALKTISRQFR CLRDAIKKQI QVTRGSLGEQ  360
GDSQGERLYR LRYVDQQLRQ QRSLQQFGMM RQPWRPQRGL PETAVSVLRA WLFEHFLHPY  420
PKDSEKITLA RQTGLTRSQV ANWFINARVR LWKPMIEDMY KDEFGEAEAG SGASPERIPV  480
ESKEKSIAEN TGEEIHESFT TPAANCSHLD PSDESSNVVT NVQNNTFATK FSFQDGAYEH  540
EKISPKPVIS STQASDGSTI GAVNGYHPSM FGDIMGNQVS LALRLQNSQI DQQSIAGRTQ  600
LREHEKTDSN VDIGKGEYYY IDQQESQHFD MYQSSVSNTT TYQSPSVMPS IQAFGERMSR  660
SIELVHPQYT TDSDVNHNRH LIDLLGTSHE ANHQAQRLSL SLGSNSLVSS VSNLIHPSYI  720
NQGVNRENNE FSFPMNQSFT NVCGTESFVS VIGNSKYLRP AQSLLDELVC VGGKTIDLSN  780
EKFIRRLSRN SKKGSLSLRA MLKAEIPSNE LFNERHELYA KLMKLIALDT IISQINVIRL  840
QIPRDVPKIS SGLSHLSLFE KETLQNRMSL QTLGIIQSNR QAWRPIRGLP ETSVAILRSW  900
LFEHFLHPYP NDSEKLMLSS QTGLSKNQVS NWFINARVRL WKPMIEEMYK EEFAESSVDA  960
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16400947563Homeobox protein Meis2
3k2a_B2e-16400947563Homeobox protein Meis2
4xrs_A2e-16400946158Homeobox protein Meis1
4xrs_B2e-16400946158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341980.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_015161897.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS91e-113BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLM0ZWL90.0M0ZWL9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-99BEL1-like homeodomain 3